PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02013.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB_related
Protein Properties Length: 168aa    MW: 17815.2 Da    PI: 4.3705
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02013.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.7e-18118162348
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +WT+eEd +l + v q+G + W+ Ia++++ gR +kqc++rw +yl
  Zmw_sc02013.1.g00070.1.sm.mk 118 SWTEEEDSILREMVLQYGERKWSVIAQCIP-GRIGKQCRERWINYL 162
                                   7*****************************.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.003111166IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-22112167IPR009057Homeodomain-like
SMARTSM007171.6E-16115164IPR001005SANT/Myb domain
CDDcd001674.33E-17118162No hitNo description
PfamPF002491.1E-16118162IPR001005SANT/Myb domain
SuperFamilySSF466893.66E-18118167IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MAGGSSVPID EVEAALMADW SPMVYFGSSY HGNDGFQNGM APASTLAGAD QIMGAPVDVS  60
SLVDSIGMTP AGLEMPEGAL AATDFGVVGG EFPAGGTMSS QQQIGSNKKP PASLKASSWT  120
EEEDSILREM VLQYGERKWS VIAQCIPGRI GKQCRERWIN YLRPNIKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gvd_A2e-15119164651MYB PROTO-ONCOGENE PROTEIN
1mbg_A2e-15119164651MYB PROTO-ONCOGENE PROTEIN
1mbh_A2e-15119164651C-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972257.14e-45PREDICTED: uncharacterized protein LOC101784221
TrEMBLK3XS585e-45K3XS58_SETIT; Uncharacterized protein
STRINGSi004755m1e-44(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101